Lineage for d7cohg_ (7coh G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024911Domain d7cohg_: 7coh G: [401873]
    Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohf_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7cohs_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
    automated match to d1v54g_
    complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohg_

PDB Entry: 7coh (more details), 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d7cohg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cohg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
gartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpfswgdgnhtffh
nprvnplptgye

SCOPe Domain Coordinates for d7cohg_:

Click to download the PDB-style file with coordinates for d7cohg_.
(The format of our PDB-style files is described here.)

Timeline for d7cohg_: