SCOPe 2.07: Domain d7cxyb_: 7cxy B:

Lineage for d7cxyb_ (7cxy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (14 species)
   not a true protein

7. Species Neosartorya fumigata [TaxId:330879] [401813] (3 PDB entries)

8. Domain d7cxyb_: 7cxy B: [401868]
   automated match to d4o1ka_
   complexed with zn

Details for d7cxyb_

PDB Entry: 7cxy, 2.2 Å

PDB Description: structural insights into novel mechanisms of inhibition of the major b-carbonic anhydrase cafb from the pathogenic fungus aspergillus fumigatus (zinc-bound form)

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d7cxyb_:

Sequence; same for both SEQRES and ATOM records:

>d7cxyb_ c.53.2.0 (B:) automated matches {Neosartorya fumigata [TaxId: 330879]}
kqsherifennrawvatkmkddpaffeklsagqtpeylyigcsdsrvpaneimgleagev
fvhrnianlvpntdlnvmsvinyavrhlqvkhivvcghyhcggvkaaltpsdlgllnpwl
rnvrdvyrlheqeldgiqdatararrlvelnviescrnviktaavqqsfherqfpvvhgw
ifdvetgllrdleidfeetlrdikkiy

Timeline for d7cxyb_:

• d7cxyb_ is new in SCOPe 2.07-stable
  
• d7cxyb_ appears in the current release, SCOPe 2.08