SCOPe 2.07: Domain d7by8d1: 7by8 D:1-146

Lineage for d7by8d1 (7by8 D:1-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries)

8. Domain d7by8d1: 7by8 D:1-146 [401809]
   Other proteins in same PDB: d7by8a2, d7by8b2, d7by8c2, d7by8d2
   automated match to d3tl2a1

Details for d7by8d1

PDB Entry: 7by8, 1.95 Å

PDB Description: malate dehydrogenase from geobacillus stearothermophilus (gs-mdh)

PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d7by8d1:

Sequence, based on SEQRES records:

>d7by8d1 c.2.1.0 (D:1-146) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
amkrkkisvigagftgattafllaqkelgdvvlvdipqlenptkgkaldmleaspvlgfd
aniigtsdyadtadsdivvitagiarkpgmsrddlvttnqkimkqvtkevvkyspncyii
vltnpvdamtytvfkesgfpknrvig

Sequence, based on observed residues (ATOM records):

>d7by8d1 c.2.1.0 (D:1-146) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
amkrkkisvigagftgattafllaqkelgdvvlvdipqlenptkgkaldmleaspvlgfd
aniigtsdyadtadsdivvitagilvttnqkimkqvtkevvkyspncyiivltnpvdamt
ytvfkesgfpknrvig

Timeline for d7by8d1:

• d7by8d1 is new in SCOPe 2.07-stable
  
• d7by8d1 appears in the current release, SCOPe 2.08