SCOPe 2.07: Domain d7brda_: 7brd A:

Lineage for d7brda_ (7brd A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 proteins)
   automatically mapped to Pfam PF01195

6. Protein automated matches [258100] (2 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [401749] (1 PDB entry)

8. Domain d7brda_: 7brd A: [401750]
   automated match to d2ptha_
   complexed with act, bme, cl, edo, peg, pge, so4

Details for d7brda_

PDB Entry: 7brd, 1.89 Å

PDB Description: crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d7brda_:

Sequence; same for both SEQRES and ATOM records:

>d7brda_ c.56.3.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mtiklivglanpgaeyaatrhnagawyvdlladrhraplreeskffgytsrinlagedvr
llvpttfmnlsgkavaamatfyrinpdeilvahdeldlppgvakfklggghgghnglkdi
isklgnnpnfhrlrvgighpgdknkvvgfvlgkppaseqkliddavdeaarcteillkdg
ltkatnrlhafkaq

Timeline for d7brda_:

• d7brda_ is new in SCOPe 2.07-stable
  
• d7brda_ appears in the current release, SCOPe 2.08