SCOP 1.63: Domain d1gerb3: 1ger B:336-450

Lineage for d1gerb3 (1ger B:336-450)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins)

6. Protein Glutathione reductase [55426] (2 species)

7. Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)

8. Domain d1gerb3: 1ger B:336-450 [40171]
   Other proteins in same PDB: d1gera1, d1gera2, d1gerb1, d1gerb2
   complexed with fad

Details for d1gerb3

PDB Entry: 1ger, 1.86 Å

PDB Description: the structure of glutathione reductase from escherichia coli at 1.86 angstroms resolution: comparison with the enzyme from human erythrocytes

SCOP Domain Sequences for d1gerb3:

Sequence; same for both SEQRES and ATOM records:

>d1gerb3 d.87.1.1 (B:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

Timeline for d1gerb3:

• d1gerb3 first appeared (with stable ids) in SCOP 1.55
  
• d1gerb3 appears in SCOP 1.61
  
• d1gerb3 appears in SCOP 1.65
  
• d1gerb3 appears in the current release, SCOPe 2.08