Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins) |
Protein Glutathione reductase [55426] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries) |
Domain d1grt_3: 1grt 364-478 [40165] Other proteins in same PDB: d1grt_1, d1grt_2 complexed with fad; mutant |
PDB Entry: 1grt (more details), 2.3 Å
SCOP Domain Sequences for d1grt_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grt_3 d.87.1.1 (364-478) Glutathione reductase {Human (Homo sapiens)} ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Timeline for d1grt_3: