Lineage for d1grt_3 (1grt 364-478)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259657Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 259658Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 259659Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins)
  6. 259693Protein Glutathione reductase [55426] (2 species)
  7. 259703Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries)
  8. 259717Domain d1grt_3: 1grt 364-478 [40165]
    Other proteins in same PDB: d1grt_1, d1grt_2
    complexed with fad; mutant

Details for d1grt_3

PDB Entry: 1grt (more details), 2.3 Å

PDB Description: human glutathione reductase a34e/r37w mutant

SCOP Domain Sequences for d1grt_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grt_3 d.87.1.1 (364-478) Glutathione reductase {Human (Homo sapiens)}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOP Domain Coordinates for d1grt_3:

Click to download the PDB-style file with coordinates for d1grt_3.
(The format of our PDB-style files is described here.)

Timeline for d1grt_3: