Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Salvia rosmarinus [TaxId:39367] [401584] (3 PDB entries) |
Domain d6zyzd_: 6zyz D: [401623] automated match to d3ctmb_ complexed with cl, nad, pxn |
PDB Entry: 6zyz (more details), 2.27 Å
SCOPe Domain Sequences for d6zyzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zyzd_ c.2.1.0 (D:) automated matches {Salvia rosmarinus [TaxId: 39367]} rrlegkvaivtggasgigastvrlfhdhgakvviadiqddlgqtladrlgrnisythcdv tdedqvralvdaavakhggvdimfsnagivegpnsifdvdkdelerlmginlvgaflaak haarvmvpakkgciiftasacteiagiaghsytaskygivglmkslavelgshgirancv spfgvltgivpddeasklmfegimskvgnlkgkiltaedvavtvlylaseeasyvsgvnl lvdggytvvnptfinvita
Timeline for d6zyzd_: