Lineage for d6zyzd_ (6zyz D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456789Species Salvia rosmarinus [TaxId:39367] [401584] (3 PDB entries)
  8. 2456793Domain d6zyzd_: 6zyz D: [401623]
    automated match to d3ctmb_
    complexed with cl, nad, pxn

Details for d6zyzd_

PDB Entry: 6zyz (more details), 2.27 Å

PDB Description: structure of the borneol dehydrogenases of salvia rosmarinus with nad+
PDB Compounds: (D:) Borneol dehydrogenase from salvia rosmarinus

SCOPe Domain Sequences for d6zyzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zyzd_ c.2.1.0 (D:) automated matches {Salvia rosmarinus [TaxId: 39367]}
rrlegkvaivtggasgigastvrlfhdhgakvviadiqddlgqtladrlgrnisythcdv
tdedqvralvdaavakhggvdimfsnagivegpnsifdvdkdelerlmginlvgaflaak
haarvmvpakkgciiftasacteiagiaghsytaskygivglmkslavelgshgirancv
spfgvltgivpddeasklmfegimskvgnlkgkiltaedvavtvlylaseeasyvsgvnl
lvdggytvvnptfinvita

SCOPe Domain Coordinates for d6zyzd_:

Click to download the PDB-style file with coordinates for d6zyzd_.
(The format of our PDB-style files is described here.)

Timeline for d6zyzd_: