SCOPe 2.07: Domain d6zilb_: 6zil B:

Lineage for d6zilb_ (6zil B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [401579] (1 PDB entry)

8. Domain d6zilb_: 6zil B: [401580]
   automated match to d3cz5a_

Details for d6zilb_

PDB Entry: 6zil, 3.12 Å

PDB Description: structure of the isolated rec domain of rcsb from salmonella enterica serovar typhimurium in the apo form

PDB Compounds: (B:) Transcriptional regulatory protein RcsB

SCOPe Domain Sequences for d6zilb_:

Sequence, based on SEQRES records:

>d6zilb_ c.23.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
nmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmpgd
kygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkalaa
lqkgkkftpesvsrllek

Sequence, based on observed residues (ATOM records):

>d6zilb_ c.23.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
nmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmgdg
itlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkalaalqkgk
kftpesvsrllek

Timeline for d6zilb_:

• d6zilb_ is new in SCOPe 2.07-stable
  
• d6zilb_ appears in the current release, SCOPe 2.08