Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.49: Proton glutamate symport protein [118214] (1 superfamily) multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer |
Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) automatically mapped to Pfam PF00375 |
Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins) |
Protein automated matches [254756] (2 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [256350] (6 PDB entries) |
Domain d6zlhb_: 6zlh B: [401539] Other proteins in same PDB: d6zlha2 automated match to d5dwyb_ complexed with 1pe, dmu, na, peg, pg4, pge, qm5 |
PDB Entry: 6zlh (more details), 2.8 Å
SCOPe Domain Sequences for d6zlhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zlhb_ f.49.1.1 (B:) automated matches {Thermococcus kodakarensis [TaxId: 69014]} ryldypvlwkilwglvlgavfgliaghfgyagavktyikpfgdlfvrllkmlvmpivlas lvvgaasisparlgrvgvkivvyylatsamavffglivgrlfnvganvnlgsgtgkaiea qppslvqtllnivptnpfaslakgevlpviffaiilgiaitylmnrneervrksaetllr vfdglaeamylivggvmqyapigvfaliayvmaeqgvrvvgplakvvgavytglflqivi tyfillkvfgidpikfirkakdamitafvtrsssgtlpvtmrvaeeemgvdkgifsftlp lgatinmdgtalyqgvtvlfvanaighpltlgqqlvvvltavlasigtagvpgagaimla mvlqsvgldltpgspvalayamilgidaildmgrtmvnvtgdlagtvivaktekeldesk wis
Timeline for d6zlhb_: