Lineage for d6zfga_ (6zfg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339527Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2339528Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2339586Protein automated matches [190238] (10 species)
    not a true protein
  7. 2339688Species Human papillomavirus type 18 [TaxId:333761] [401524] (2 PDB entries)
  8. 2339689Domain d6zfga_: 6zfg A: [401533]
    Other proteins in same PDB: d6zfgb2
    automated match to d2o02a_
    complexed with fsc, gol, tpo

Details for d6zfga_

PDB Entry: 6zfg (more details), 1.85 Å

PDB Description: 14-3-3 zeta chimera with 18e6 and fusicoccin
PDB Compounds: (A:) 14-3-3 protein zeta/delta,Protein E6

SCOPe Domain Sequences for d6zfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zfga_ a.118.7.1 (A:) automated matches {Human papillomavirus type 18 [TaxId: 333761]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsawr
vvssieqktegaaaaqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeisaaamqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtggggrrretqv

SCOPe Domain Coordinates for d6zfga_:

Click to download the PDB-style file with coordinates for d6zfga_.
(The format of our PDB-style files is described here.)

Timeline for d6zfga_: