Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (10 species) not a true protein |
Species Human papillomavirus type 18 [TaxId:333761] [401524] (2 PDB entries) |
Domain d6zfga_: 6zfg A: [401533] Other proteins in same PDB: d6zfgb2 automated match to d2o02a_ complexed with fsc, gol, tpo |
PDB Entry: 6zfg (more details), 1.85 Å
SCOPe Domain Sequences for d6zfga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zfga_ a.118.7.1 (A:) automated matches {Human papillomavirus type 18 [TaxId: 333761]} mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsawr vvssieqktegaaaaqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk mkgdyyrylaevaagddkkgivdqsqqayqeafeisaaamqpthpirlglalnfsvfyye ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtggggrrretqv
Timeline for d6zfga_: