Lineage for d6z81d1 (6z81 D:1-107)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492837Species Escherichia coli [TaxId:562] [270176] (3 PDB entries)
  8. 2492840Domain d6z81d1: 6z81 D:1-107 [401516]
    automated match to d4yduc1
    complexed with act, amp, na, ni, peg, qcb, so4, zn

Details for d6z81d1

PDB Entry: 6z81 (more details), 2.31 Å

PDB Description: tsabd bound to the inhibitor
PDB Compounds: (D:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d6z81d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z81d1 c.55.1.0 (D:1-107) automated matches {Escherichia coli [TaxId: 562]}
mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala
ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkng

SCOPe Domain Coordinates for d6z81d1:

Click to download the PDB-style file with coordinates for d6z81d1.
(The format of our PDB-style files is described here.)

Timeline for d6z81d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6z81d2