Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Escherichia coli [TaxId:562] [270176] (3 PDB entries) |
Domain d6z81d1: 6z81 D:1-107 [401516] automated match to d4yduc1 complexed with act, amp, na, ni, peg, qcb, so4, zn |
PDB Entry: 6z81 (more details), 2.31 Å
SCOPe Domain Sequences for d6z81d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z81d1 c.55.1.0 (D:1-107) automated matches {Escherichia coli [TaxId: 562]} mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkng
Timeline for d6z81d1: