Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:566679] [384270] (9 PDB entries) |
Domain d6zaua1: 6zau A:3-154 [401489] Other proteins in same PDB: d6zaua3 automated match to d1bq5a1 complexed with cu, gol, no, no2, so4 |
PDB Entry: 6zau (more details), 1.3 Å
SCOPe Domain Sequences for d6zaua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zaua1 b.6.1.0 (A:3-154) automated matches {Bradyrhizobium sp. [TaxId: 566679]} dlklprqrvdlvappfvhvheqatkqgpkimefklvvqekkmvidekgttfqamtfngsm pgplmvvhegdyvevtlvnpatntmphnidfhsatgalgggaltlinpgeqvvlrwkatr tgvfvyhcapggpmipwhvvsgmngavmvlpr
Timeline for d6zaua1: