Lineage for d6zaxa2 (6zax A:155-341)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382106Species Bradyrhizobium sp. [TaxId:566679] [384270] (9 PDB entries)
  8. 2382120Domain d6zaxa2: 6zax A:155-341 [401478]
    Other proteins in same PDB: d6zaxa3
    automated match to d1bq5a2
    complexed with cu, gol, no2, so4

Details for d6zaxa2

PDB Entry: 6zax (more details), 1.48 Å

PDB Description: nitrite-bound copper nitrite reductase from bradyrhizobium sp. ors 375 (two-domain) at low dose (0.5 mgy)
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6zaxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zaxa2 b.6.1.0 (A:155-341) automated matches {Bradyrhizobium sp. [TaxId: 566679]}
dglndghghslrydriyyigeqdlyvprdekgnfksydspgeaysdteevmrkltpthvv
fngkagaltgknalnanvgenvlivhsqanrdsrphligghgdyvwetgkfsnapetgle
twfirggsagaalykflqpgiyayvthnlieaanlgatahfkvegkwnddlmtqvkapad
iptgstn

SCOPe Domain Coordinates for d6zaxa2:

Click to download the PDB-style file with coordinates for d6zaxa2.
(The format of our PDB-style files is described here.)

Timeline for d6zaxa2: