Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Methanolacinia paynteri [TaxId:694436] [401296] (3 PDB entries) |
Domain d6yk9e1: 6yk9 E:2-242 [401400] Other proteins in same PDB: d6yk9a2, d6yk9b2, d6yk9c2, d6yk9e2 automated match to d4jjfa1 complexed with 5gp, edo, feg, gly, gmp |
PDB Entry: 6yk9 (more details), 1.7 Å
SCOPe Domain Sequences for d6yk9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yk9e1 c.2.1.0 (E:2-242) automated matches {Methanolacinia paynteri [TaxId: 694436]} tikkvailgagcyrthsatgitnfaracevaemvgkpeiamthstiamaaelkylagidn ivisdpsfageftvvkdfdynevikahkenpetimpkirekvnelaktvpkppkgaihfv hpedlglkvttddreavrdadliitwlpkgdmqkgiiekfagdikqgaiithactipttl fykifeelgiadkvevtsyhpgavpemkgqvyiaegyaseeaintiyelgkkarghafkl p
Timeline for d6yk9e1: