SCOPe 2.07: Domain d6yk9e1: 6yk9 E:2-242

Lineage for d6yk9e1 (6yk9 E:2-242)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Methanolacinia paynteri [TaxId:694436] [401296] (3 PDB entries)

8. Domain d6yk9e1: 6yk9 E:2-242 [401400]
   Other proteins in same PDB: d6yk9a2, d6yk9b2, d6yk9c2, d6yk9e2
   automated match to d4jjfa1
   complexed with 5gp, edo, feg, gly, gmp

Details for d6yk9e1

PDB Entry: 6yk9, 1.7 Å

PDB Description: [fe]-hydrogenase from methanolacinia paynteri with bound guanylylpyridinol at 1.7-a resolution

PDB Compounds: (E:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6yk9e1:

Sequence; same for both SEQRES and ATOM records:

>d6yk9e1 c.2.1.0 (E:2-242) automated matches {Methanolacinia paynteri [TaxId: 694436]}
tikkvailgagcyrthsatgitnfaracevaemvgkpeiamthstiamaaelkylagidn
ivisdpsfageftvvkdfdynevikahkenpetimpkirekvnelaktvpkppkgaihfv
hpedlglkvttddreavrdadliitwlpkgdmqkgiiekfagdikqgaiithactipttl
fykifeelgiadkvevtsyhpgavpemkgqvyiaegyaseeaintiyelgkkarghafkl
p

Timeline for d6yk9e1:

• d6yk9e1 is new in SCOPe 2.07-stable
  
• d6yk9e1 appears in the current release, SCOPe 2.08