Lineage for d6yohc_ (6yoh C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384329Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 2384330Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 2384331Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries)
  8. 2384385Domain d6yohc_: 6yoh C: [401390]
    automated match to d1okoa_
    complexed with ca, p4h

Details for d6yohc_

PDB Entry: 6yoh (more details), 1.84 Å

PDB Description: leca from pseudomonas aeruginosa in complex with a catechol cas no. 61445-50-9
PDB Compounds: (C:) PA-I galactophilic lectin

SCOPe Domain Sequences for d6yohc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yohc_ b.18.1.16 (C:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d6yohc_:

Click to download the PDB-style file with coordinates for d6yohc_.
(The format of our PDB-style files is described here.)

Timeline for d6yohc_: