Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (31 species) not a true protein |
Species Streptomyces lividans [TaxId:1200984] [401340] (4 PDB entries) |
Domain d6yrdf_: 6yrd F: [401345] automated match to d4gu7a_ complexed with hem, mg, o, pg4 |
PDB Entry: 6yrd (more details), 1.75 Å
SCOPe Domain Sequences for d6yrdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yrdf_ d.58.4.0 (F:) automated matches {Streptomyces lividans [TaxId: 1200984]} pepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgig seawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrlr gavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqkyl hdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnmp fgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaad fledl
Timeline for d6yrdf_: