SCOPe 2.07: Domain d6yrjb_: 6yrj B:

Lineage for d6yrjb_ (6yrj B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (31 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1200984] [401340] (4 PDB entries)

8. Domain d6yrjb_: 6yrj B: [401342]
   automated match to d4gu7a_
   complexed with hem, mg

Details for d6yrjb_

PDB Entry: 6yrj, 1.85 Å

PDB Description: sfx structure of dye-type peroxidase dtpb in the ferric state

PDB Compounds: (B:) Putative iron-dependent peroxidase

SCOPe Domain Sequences for d6yrjb_:

Sequence; same for both SEQRES and ATOM records:

>d6yrjb_ d.58.4.0 (B:) automated matches {Streptomyces lividans [TaxId: 1200984]}
epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
dfledl

Timeline for d6yrjb_:

• d6yrjb_ is new in SCOPe 2.07-stable
  
• d6yrjb_ appears in the current release, SCOPe 2.08