Lineage for d6y7ea2 (6y7e A:508-638)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382316Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)
  8. 2382331Domain d6y7ea2: 6y7e A:508-638 [401240]
    Other proteins in same PDB: d6y7ea1, d6y7eb1, d6y7eb3
    automated match to d3sbqa2
    complexed with b3p, ca, cl, cua, fmt, na, trs, zn; mutant

Details for d6y7ea2

PDB Entry: 6y7e (more details), 1.6 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase mutant, h494a
PDB Compounds: (A:) nitrous-oxide reductase

SCOPe Domain Sequences for d6y7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y7ea2 b.6.1.0 (A:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

SCOPe Domain Coordinates for d6y7ea2:

Click to download the PDB-style file with coordinates for d6y7ea2.
(The format of our PDB-style files is described here.)

Timeline for d6y7ea2: