Lineage for d6y3la_ (6y3l A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582037Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2582101Protein automated matches [190058] (11 species)
    not a true protein
  7. 2582149Species Corylus avellana [TaxId:13451] [369994] (5 PDB entries)
  8. 2582153Domain d6y3la_: 6y3l A: [401228]
    automated match to d4a8ua_

Details for d6y3la_

PDB Entry: 6y3l (more details)

PDB Description: nmr solution structure of the hazelnut allergen cor a 1.0404
PDB Compounds: (A:) Major allergen variant Cor a 1.0404

SCOPe Domain Sequences for d6y3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y3la_ d.129.3.1 (A:) automated matches {Corylus avellana [TaxId: 13451]}
gvfsyedeatsvipparlfksfvldadnlipkvapqhftsaenlegnggpgtikkitfae
gnefkymkhkveeidhanfkycysiieggplghtlekipyeikmaaaphgggsilkitsk
yhtkgnasineeeikagkekaaglfkaveayllahpdayc

SCOPe Domain Coordinates for d6y3la_:

Click to download the PDB-style file with coordinates for d6y3la_.
(The format of our PDB-style files is described here.)

Timeline for d6y3la_: