SCOPe 2.07: Domain d6xunb1: 6xun B:1-108

Lineage for d6xunb1 (6xun B:1-108)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6xunb1: 6xun B:1-108 [401181]
   Other proteins in same PDB: d6xunb2, d6xund2, d6xunl2
   automated match to d1ad0a1
   complexed with fuc, gal, gol, nag, sia

Details for d6xunb1

PDB Entry: 6xun, 2.41 Å

PDB Description: ab 5b1 bound to ca19-9

PDB Compounds: (B:) light chain

SCOPe Domain Sequences for d6xunb1:

Sequence; same for both SEQRES and ATOM records:

>d6xunb1 b.1.1.0 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgsssnigsnfvywyqqlpgtapklliyrnnqrpsgvp
drfsgsrsgtsaslaisglrsedeadyycaawddslgghyvfgtgtkvtvlr

Timeline for d6xunb1:

• d6xunb1 is new in SCOPe 2.07-stable
  
• d6xunb1 appears in the current release, SCOPe 2.08