Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6xunb1: 6xun B:1-108 [401181] Other proteins in same PDB: d6xunb2, d6xund2, d6xunl2 automated match to d1ad0a1 complexed with fuc, gal, gol, nag, sia |
PDB Entry: 6xun (more details), 2.41 Å
SCOPe Domain Sequences for d6xunb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xunb1 b.1.1.0 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsvltqppsasgtpgqrvtiscsgsssnigsnfvywyqqlpgtapklliyrnnqrpsgvp drfsgsrsgtsaslaisglrsedeadyycaawddslgghyvfgtgtkvtvlr
Timeline for d6xunb1:
View in 3D Domains from other chains: (mouse over for more information) d6xund1, d6xund2, d6xunl1, d6xunl2 |