Lineage for d6xndd_ (6xnd D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415303Protein Avidin [50880] (1 species)
  7. 2415304Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)
  8. 2415308Domain d6xndd_: 6xnd D: [401178]
    automated match to d1ldoa_
    complexed with nag, v8m

Details for d6xndd_

PDB Entry: 6xnd (more details), 1.58 Å

PDB Description: avidin-biotin-phenol
PDB Compounds: (D:) Avidin

SCOPe Domain Sequences for d6xndd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xndd_ b.61.1.1 (D:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOPe Domain Coordinates for d6xndd_:

Click to download the PDB-style file with coordinates for d6xndd_.
(The format of our PDB-style files is described here.)

Timeline for d6xndd_: