Class b: All beta proteins [48724] (178 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein Avidin [50880] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries) |
Domain d6xndd_: 6xnd D: [401178] automated match to d1ldoa_ complexed with nag, v8m |
PDB Entry: 6xnd (more details), 1.58 Å
SCOPe Domain Sequences for d6xndd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xndd_ b.61.1.1 (D:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]} kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr l
Timeline for d6xndd_: