SCOPe 2.07: Domain d6xuma_: 6xum A:

Lineage for d6xuma_ (6xum A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (155 PDB entries)
   Uniprot P15121

8. Domain d6xuma_: 6xum A: [401166]
   automated match to d4lbsa_
   complexed with 30l, cit, nap; mutant

Details for d6xuma_

PDB Entry: 6xum, 0.97 Å

PDB Description: human aldose reductase mutant l300/301a in complex with a ligand with an idd structure ({5-fluoro-2-[(3-nitrobenzyl) carbamoyl]phenoxy}acetic acid)

PDB Compounds: (A:) Aldo-keto reductase family 1 member B1

SCOPe Domain Sequences for d6xuma_:

Sequence; same for both SEQRES and ATOM records:

>d6xuma_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
aasctshkdypfheef

Timeline for d6xuma_:

• d6xuma_ is new in SCOPe 2.07-stable
  
• d6xuma_ appears in the current release, SCOPe 2.08