Lineage for d6xb9h_ (6xb9 H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424451Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2424530Protein automated matches [191276] (4 species)
    not a true protein
  7. 2424531Species Azotobacter vinelandii [TaxId:354] [399261] (2 PDB entries)
  8. 2424539Domain d6xb9h_: 6xb9 H: [401063]
    automated match to d3ussa_
    complexed with 3oh, cl, fe, mg

Details for d6xb9h_

PDB Entry: 6xb9 (more details), 2.25 Å

PDB Description: crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid
PDB Compounds: (H:) Cysteine dioxygenase type I protein

SCOPe Domain Sequences for d6xb9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xb9h_ b.82.1.19 (H:) automated matches {Azotobacter vinelandii [TaxId: 354]}
plrldrlrdfvsalgelldrhpdeesvlregrsllgelvrhddwlpeefaqpdperyqqy
llhadsrqrfsvvsfvwgpgqttpvhdhrvwgligmlrgaedaqsfelgaeglrpigdpv
rlspgqveavsprigdihrvfnaspdqpsisihvyganigavrravylpdgsekpfisgy
snqflpniwdqske

SCOPe Domain Coordinates for d6xb9h_:

Click to download the PDB-style file with coordinates for d6xb9h_.
(The format of our PDB-style files is described here.)

Timeline for d6xb9h_: