Class b: All beta proteins [48724] (178 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Tumor necrosis factor (TNF) [49848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries) |
Domain d6x86a_: 6x86 A: [401057] automated match to d1a8ma_ complexed with uty |
PDB Entry: 6x86 (more details), 2.93 Å
SCOPe Domain Sequences for d6x86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x86a_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg qgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql ekgdrlsaeinrpdyldfaesgqvyfgiial
Timeline for d6x86a_: