Class b: All beta proteins [48724] (178 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Tumor necrosis factor (TNF) [49848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries) |
Domain d6x83e_: 6x83 E: [401055] automated match to d1a8ma_ complexed with uts |
PDB Entry: 6x83 (more details), 2.83 Å
SCOPe Domain Sequences for d6x83e_:
Sequence, based on SEQRES records: (download)
>d6x83e_ b.22.1.1 (E:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} sdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqg cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek gdrlsaeinrpdyldfaesgqvyfgiial
>d6x83e_ b.22.1.1 (E:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} sdkpvahvvanpqaegqlqwlnrlangvelrdnqlvvpseglyliysqvlfkgqgcpvll thtisriavsyqtkvnllsaikspcqkpwyepiylggvfqlekgdrlsaeinrpdyldfs gqvyfgiial
Timeline for d6x83e_: