SCOPe 2.07: Domain d6wtul2: 6wtu L:115-215

Lineage for d6wtul2 (6wtu L:115-215)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6wtul2: 6wtu L:115-215 [401013]
   Other proteins in same PDB: d6wtuc1, d6wtuf1, d6wtui1, d6wtul1
   automated match to d1lila2

Details for d6wtul2

PDB Entry: 6wtu, 2.55 Å

PDB Description: plasmodium vivax reticulocyte binding protein 2b (pvrbp2b) bound to human monoclonal antibody 273264

PDB Compounds: (L:) 273264 Fab light chain

SCOPe Domain Sequences for d6wtul2:

Sequence, based on SEQRES records:

>d6wtul2 b.1.1.2 (L:115-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Sequence, based on observed residues (ATOM records):

>d6wtul2 b.1.1.2 (L:115-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawdsspvkagvetttpskqsn
nkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d6wtul2:

• d6wtul2 is new in SCOPe 2.07-stable
  
• d6wtul2 appears in the current release, SCOPe 2.08