Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6vmke1: 6vmk e:1-106 [401007] Other proteins in same PDB: d6vmka_, d6vmkb2, d6vmkc_, d6vmkd_, d6vmke2, d6vmkf_, d6vmkg_, d6vmkh2, d6vmki_, d6vmkj2, d6vmkk2, d6vmkl2, d6vmkm_, d6vmkn2, d6vmko2, d6vmkp_, d6vmkq2, d6vmkr2, d6vmks_, d6vmkt2, d6vmku2, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky2 automated match to d1dn0a1 complexed with gol, so4 |
PDB Entry: 6vmk (more details), 3.01 Å
SCOPe Domain Sequences for d6vmke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vmke1 b.1.1.0 (e:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitckasqnvdtdvawfqqkpgkapkglirsassrysgvps rfsgsgsgtdftltisslqpedfatyycqqynnypltfgqgtkvei
Timeline for d6vmke1:
View in 3D Domains from other chains: (mouse over for more information) d6vmka_, d6vmkb1, d6vmkb2, d6vmkc_, d6vmkd_, d6vmkf_, d6vmkg_, d6vmkh1, d6vmkh2, d6vmki_, d6vmkj1, d6vmkj2, d6vmkk1, d6vmkk2, d6vmkl1, d6vmkl2, d6vmkm_, d6vmkn1, d6vmkn2, d6vmko1, d6vmko2, d6vmkp_, d6vmkq1, d6vmkq2, d6vmkr1, d6vmkr2, d6vmks_, d6vmkt1, d6vmkt2, d6vmku1, d6vmku2, d6vmkv_, d6vmkw_, d6vmkx_, d6vmky1, d6vmky2 |