SCOPe 2.07: Domain d6wtvc1: 6wtv C:7-114

Lineage for d6wtvc1 (6wtv C:7-114)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
Domain d6wtvc1: 6wtv C:7-114 [400986]
Other proteins in same PDB: d6wtvc2, d6wtvf2, d6wtvi2
automated match to d1lila1

Details for d6wtvc1

PDB Entry: 6wtv (more details), 3.05 Å

PDB Description: plasmodium vivax reticulocyte binding protein 2b (pvrbp2b) bound to human monoclonal antibody 258259

PDB Compounds: (C:) 258259 Fab light chain

SCOPe Domain Sequences for d6wtvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wtvc1 b.1.1.0 (C:7-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqapsvsvapgqtaritcggdnigrktvnwyqqkpgqapvlviyydndrpsgiperf
sgsnsgnmatlsisrvevgdeadyycqvwdsnndhpvfgggtkltvvg

SCOPe Domain Coordinates for d6wtvc1:

Click to download the PDB-style file with coordinates for d6wtvc1.
(The format of our PDB-style files is described here.)

Timeline for d6wtvc1: