Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6wqof1: 6wqo F:6-111 [400951] Other proteins in same PDB: d6wqoc2, d6wqof2 automated match to d1dn0a1 |
PDB Entry: 6wqo (more details), 3.15 Å
SCOPe Domain Sequences for d6wqof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wqof1 b.1.1.0 (F:6-111) automated matches {Human (Homo sapiens) [TaxId: 9606]} divmtqspsslsasvgdrisiscrasqgvnsalawyqqkpgkapklliydastlesgvps rfsgsgsgtdfaltinslqpedfatyycqqfnsypltfgggtkvei
Timeline for d6wqof1: