SCOPe 2.07: Domain d6weee1: 6wee E:2-159

Lineage for d6weee1 (6wee E:2-159)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (2 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries)

8. Domain d6weee1: 6wee E:2-159 [400944]
   Other proteins in same PDB: d6weeb2, d6weed2, d6weee2
   automated match to d3lzlb_
   complexed with cu, gol, so4, trs

Details for d6weee1

PDB Entry: 6wee, 2.3 Å

PDB Description: copper-bound m88i variant of campylobacter jejuni p19

PDB Compounds: (E:) Uncharacterized protein

SCOPe Domain Sequences for d6weee1:

Sequence; same for both SEQRES and ATOM records:

>d6weee1 b.1.33.0 (E:2-159) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpivaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

Timeline for d6weee1:

• d6weee1 is new in SCOPe 2.07-stable
  
• d6weee1 appears in the current release, SCOPe 2.08