SCOPe 2.07: Domain d6wcyb_: 6wcy B:

Lineage for d6wcyb_ (6wcy B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)

8. Domain d6wcyb_: 6wcy B: [400893]
   automated match to d4gr7a_
   complexed with so4; mutant

Details for d6wcyb_

PDB Entry: 6wcy, 1.2 Å

PDB Description: n160d deamidation mutant of human gammad-crystallin

PDB Compounds: (B:) Gamma-crystallin D

SCOPe Domain Sequences for d6wcyb_:

Sequence; same for both SEQRES and ATOM records:

>d6wcyb_ b.11.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatdarvgslrrvid

Timeline for d6wcyb_:

• d6wcyb_ is new in SCOPe 2.07-stable
  
• d6wcyb_ appears in the current release, SCOPe 2.08