Lineage for d6vuoa1 (6vuo A:3-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365625Domain d6vuoa1: 6vuo A:3-124 [400874]
    automated match to d4lrnl_
    complexed with edo; mutant

Details for d6vuoa1

PDB Entry: 6vuo (more details), 1.45 Å

PDB Description: reverse transcriptase diabody with s82bc/r83t mutation
PDB Compounds: (A:) single-chain Fv

SCOPe Domain Sequences for d6vuoa1:

Sequence, based on SEQRES records: (download)

>d6vuoa1 b.1.1.0 (A:3-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfslstsgigvtwvrqapgkglewlatiwwdddnry
adsvkgrftisadtskntaylqmncltaedtavyycaqsaitsvtdsamdhwgqgtlvtv
ss

Sequence, based on observed residues (ATOM records): (download)

>d6vuoa1 b.1.1.0 (A:3-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfslstgigvtwvrqapgkglewlatiwwdddnrya
dsvkgrftisadtskntaylqmncltaedtavyycaqsaitvtdsamdhwgqgtlvtvss

SCOPe Domain Coordinates for d6vuoa1:

Click to download the PDB-style file with coordinates for d6vuoa1.
(The format of our PDB-style files is described here.)

Timeline for d6vuoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6vuoa2