SCOPe 2.07: Domain d6vqnb1: 6vqn B:18-134

Lineage for d6vqnb1 (6vqn B:18-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6vqnb1: 6vqn B:18-134 [400808]
   Other proteins in same PDB: d6vqna2, d6vqnb2, d6vqnc2
   automated match to d5x8ma_
   complexed with r81

Details for d6vqnb1

PDB Entry: 6vqn, 2.49 Å

PDB Description: co-crystal structure of human pd-l1 complexed with compound a

PDB Compounds: (B:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d6vqnb1:

Sequence; same for both SEQRES and ATOM records:

>d6vqnb1 b.1.1.0 (B:18-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

Timeline for d6vqnb1:

• d6vqnb1 is new in SCOPe 2.07-stable
  
• d6vqnb1 appears in the current release, SCOPe 2.08