SCOPe 2.07: Domain d6vn8a1: 6vn8 A:840-1132

Lineage for d6vn8a1 (6vn8 A:840-1132)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d6vn8a1: 6vn8 A:840-1132 [400777]
   Other proteins in same PDB: d6vn8a2
   automated match to d4hgeb_
   complexed with 3jw

Details for d6vn8a1

PDB Entry: 6vn8, 1.9 Å

PDB Description: jak2 jh1 in complex with baricitinib

PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d6vn8a1:

Sequence; same for both SEQRES and ATOM records:

>d6vn8a1 d.144.1.0 (A:840-1132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag

Timeline for d6vn8a1:

• d6vn8a1 is new in SCOPe 2.07-stable
  
• d6vn8a1 appears in the current release, SCOPe 2.08