Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries) |
Domain d6vn8a1: 6vn8 A:840-1132 [400777] Other proteins in same PDB: d6vn8a2 automated match to d4hgeb_ complexed with 3jw |
PDB Entry: 6vn8 (more details), 1.9 Å
SCOPe Domain Sequences for d6vn8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vn8a1 d.144.1.0 (A:840-1132) automated matches {Human (Homo sapiens) [TaxId: 9606]} dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag
Timeline for d6vn8a1: