Lineage for d6vnma1 (6vnm A:840-1132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2591422Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 2592138Domain d6vnma1: 6vnm A:840-1132 [400721]
    Other proteins in same PDB: d6vnma2
    automated match to d4hgeb_
    complexed with r5y

Details for d6vnma1

PDB Entry: 6vnm (more details), 2.2 Å

PDB Description: jak2 jh1 in complex with sy5-103
PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d6vnma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vnma1 d.144.1.0 (A:840-1132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag

SCOPe Domain Coordinates for d6vnma1:

Click to download the PDB-style file with coordinates for d6vnma1.
(The format of our PDB-style files is described here.)

Timeline for d6vnma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6vnma2
View in 3D
Domains from other chains:
(mouse over for more information)
d6vnmb_