SCOPe 2.07: Domain d6vnld_: 6vnl D:

Lineage for d6vnld_ (6vnl D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d6vnld_: 6vnl D: [400719]
   Other proteins in same PDB: d6vnla2, d6vnlb2
   automated match to d4hgeb_
   complexed with 5w2

Details for d6vnld_

PDB Entry: 6vnl, 2.4 Å

PDB Description: jak2 jh1 in complex with sg3-179

PDB Compounds: (D:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d6vnld_:

Sequence; same for both SEQRES and ATOM records:

>d6vnld_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereieil
kslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqick
gmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwya
peslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhliell
knngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma

Timeline for d6vnld_:

• d6vnld_ is new in SCOPe 2.07-stable
  
• d6vnld_ appears in the current release, SCOPe 2.08