SCOPe 2.07: Domain d6ud1b_: 6ud1 B:

Lineage for d6ud1b_ (6ud1 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)

8. Domain d6ud1b_: 6ud1 B: [400653]
   automated match to d4ekva_
   complexed with cl, dv7

Details for d6ud1b_

PDB Entry: 6ud1, 1.55 Å

PDB Description: spectroscopic and structural characterization of a genetically encoded direct sensor for protein-ligand interactions

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d6ud1b_:

Sequence; same for both SEQRES and ATOM records:

>d6ud1b_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaxkstlvghdtftkv
kp

Timeline for d6ud1b_:

• d6ud1b_ is new in SCOPe 2.07-stable
  
• d6ud1b_ appears in the current release, SCOPe 2.08