SCOPe 2.07: Domain d6tiyb1: 6tiy B:1-243

Lineage for d6tiyb1 (6tiy B:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Drosophila melanogaster [TaxId:7227] [400541] (3 PDB entries)

8. Domain d6tiyb1: 6tiy B:1-243 [400651]
   Other proteins in same PDB: d6tiya2, d6tiyb2, d6tiyc2, d6tiyd2, d6tiye_
   automated match to d5bmvb1
   complexed with g2p, gol, gtp, mg, so4

Details for d6tiyb1

PDB Entry: 6tiy, 2.29 Å

PDB Description: drosophila gmpcpp-tubulin

PDB Compounds: (B:) Tubulin beta-1 chain

SCOPe Domain Sequences for d6tiyb1:

Sequence; same for both SEQRES and ATOM records:

>d6tiyb1 c.32.1.1 (B:1-243) automated matches {Drosophila melanogaster [TaxId: 7227]}
mreivhiqagqcgnqigakfweiisdehgidatgayhgdsdlqlerinvyyneasggkyv
pravlvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkeaescdclqgfqlthslgggtgsgmgtlliskireeypdrimntysvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsltmsgvttcl
rfp

Timeline for d6tiyb1:

• d6tiyb1 is new in SCOPe 2.07-stable
  
• d6tiyb1 appears in the current release, SCOPe 2.08