SCOPe 2.07: Domain d6txpa_: 6txp A:

Lineage for d6txpa_ (6txp A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (155 PDB entries)
   Uniprot P15121

8. Domain d6txpa_: 6txp A: [400624]
   automated match to d1el3a_
   complexed with 4g7, cit, nap; mutant

Details for d6txpa_

PDB Entry: 6txp, 0.95 Å

PDB Description: human aldose reductase mutant l300a in complex with a ligand with an idd structure (3-({[2-(carboxymethoxy)-4-fluorobenzoyl]amino}methyl) benzoic acid)

PDB Compounds: (A:) Aldo-keto reductase family 1 member B1

SCOPe Domain Sequences for d6txpa_:

Sequence; same for both SEQRES and ATOM records:

>d6txpa_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
alsctshkdypfheef

Timeline for d6txpa_:

• d6txpa_ is new in SCOPe 2.07-stable
  
• d6txpa_ appears in the current release, SCOPe 2.08