SCOPe 2.07: Domain d6tpla2: 6tpl A:658-752

Lineage for d6tpla2 (6tpl A:658-752)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)

6. Protein Intimin [49375] (1 species)

7. Species Escherichia coli [TaxId:562] [49376] (5 PDB entries)
   an enteropathogenic serotype

8. Domain d6tpla2: 6tpl A:658-752 [400612]
   automated match to d1f00i1
   complexed with cl, mg

Details for d6tpla2

PDB Entry: 6tpl, 1.8 Å

PDB Description: d0-d1 domain of intimin

PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d6tpla2:

Sequence; same for both SEQRES and ATOM records:

>d6tpla2 b.1.14.1 (A:658-752) Intimin {Escherichia coli [TaxId: 562]}
asiteikadkttavangqdaitytvkvmkgdkpvsnqevtftttlgklsnstektdtngy
akvtltsttpgkslvsarvsdvavdvkapevefft

Timeline for d6tpla2:

• d6tpla2 is new in SCOPe 2.07-stable
  
• d6tpla2 appears in the current release, SCOPe 2.08