SCOPe 2.07: Domain d5s8pa1: 5s8p A:1315-1433

Lineage for d5s8pa1 (5s8p A:1315-1433)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5s8pa1: 5s8p A:1315-1433 [400496]
   Other proteins in same PDB: d5s8pa2, d5s8pb2
   automated match to d3mb3a_
   complexed with 3pf, ca, edo

Details for d5s8pa1

PDB Entry: 5s8p, 1.41 Å

PDB Description: xchem group deposition -- crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with e07179c (space group p212121)

PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5s8pa1:

Sequence; same for both SEQRES and ATOM records:

>d5s8pa1 a.29.2.0 (A:1315-1433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagn
yespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhk

Timeline for d5s8pa1:

• d5s8pa1 is new in SCOPe 2.07-stable
  
• d5s8pa1 appears in the current release, SCOPe 2.08