Lineage for d1qalb4 (1qal B:6-90)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33949Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 33950Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 33951Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 33952Protein Copper amine oxidase, domain N [55385] (1 species)
  7. 33953Species Escherichia coli [TaxId:562] [55386] (9 PDB entries)
  8. 33971Domain d1qalb4: 1qal B:6-90 [40020]
    Other proteins in same PDB: d1qala1, d1qala2, d1qala3, d1qalb1, d1qalb2, d1qalb3

Details for d1qalb4

PDB Entry: 1qal (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants

SCOP Domain Sequences for d1qalb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qalb4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1qalb4:

Click to download the PDB-style file with coordinates for d1qalb4.
(The format of our PDB-style files is described here.)

Timeline for d1qalb4: