Lineage for d6qsuu2 (6qsu U:106-238)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427322Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2427323Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2427381Protein automated matches [192998] (2 species)
    not a true protein
  7. 2427382Species Helicobacter pylori [TaxId:210] [397956] (2 PDB entries)
  8. 2427405Domain d6qsuu2: 6qsu U:106-238 [400145]
    Other proteins in same PDB: d6qsua1, d6qsuc1, d6qsue1, d6qsug1, d6qsui1, d6qsuk1, d6qsum1, d6qsuo1, d6qsuq1, d6qsus1, d6qsuu1, d6qsuw1
    automated match to d1e9ya1
    complexed with bme, ni

Details for d6qsuu2

PDB Entry: 6qsu (more details), 2.4 Å

PDB Description: helicobacter pylori urease with bme bound in the active site
PDB Compounds: (U:) urease subunit alpha

SCOPe Domain Sequences for d6qsuu2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qsuu2 b.85.3.1 (U:106-238) automated matches {Helicobacter pylori [TaxId: 210]}
lvpgelflkneditinegkkavsvkvknvgdrpvqigshfhffevnrcldfdrektfgkr
ldiasgtavrfepgeeksvelidiggnrrifgfnalvdrqadneskkialhrakergfhg
tksddnyvktike

SCOPe Domain Coordinates for d6qsuu2:

Click to download the PDB-style file with coordinates for d6qsuu2.
(The format of our PDB-style files is described here.)

Timeline for d6qsuu2: