Lineage for d6m38l2 (6m38 L:109-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364341Domain d6m38l2: 6m38 L:109-214 [400056]
    Other proteins in same PDB: d6m38l1
    automated match to d5vzrb2
    complexed with 29e, cl, clr, dmu, na, y01; mutant

Details for d6m38l2

PDB Entry: 6m38 (more details), 3 Å

PDB Description: x-ray structure of a drosophila dopamine transporter with subsiteb mutations (d121g/s426m) in s-duloxetine bound form
PDB Compounds: (L:) Antibody fragment 9D5 Light chain

SCOPe Domain Sequences for d6m38l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m38l2 b.1.1.2 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d6m38l2:

Click to download the PDB-style file with coordinates for d6m38l2.
(The format of our PDB-style files is described here.)

Timeline for d6m38l2: