Lineage for d6m4zd_ (6m4z D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2429246Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2429247Protein automated matches [193506] (5 species)
    not a true protein
  7. 2429248Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2429656Domain d6m4zd_: 6m4z D: [399977]
    automated match to d3peoa_
    complexed with nh2

Details for d6m4zd_

PDB Entry: 6m4z (more details), 2.8 Å

PDB Description: co-crystal structure of ac-achbpp in complex with alpha-conotoxin [d11a]lvia
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d6m4zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m4zd_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d6m4zd_:

Click to download the PDB-style file with coordinates for d6m4zd_.
(The format of our PDB-style files is described here.)

Timeline for d6m4zd_: