SCOPe 2.07: Domain d6lzrb1: 6lzr B:1-530

Lineage for d6lzrb1 (6lzr B:1-530)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [348941] (8 PDB entries)

8. Domain d6lzrb1: 6lzr B:1-530 [399965]
   Other proteins in same PDB: d6lzra2, d6lzrb2
   automated match to d4pfua_
   complexed with ca, cl, edo, mg, nag

Details for d6lzrb1

PDB Entry: 6lzr, 1.5 Å

PDB Description: chitin-specific solute binding protein from vibrio harveyi co- crystalized with chitotetraose.

PDB Compounds: (B:) Peptide ABC transporter, periplasmic peptide-binding protein

SCOPe Domain Sequences for d6lzrb1:

Sequence; same for both SEQRES and ATOM records:

>d6lzrb1 c.94.1.0 (B:1-530) automated matches {Vibrio harveyi [TaxId: 673519]}
rseltihpkefttfvrnfnpflgatnlhtttdfiyeplvvfnemhgntpvfrlaenfqms
ddlmsvtfdirkgvkwsdgeaftaddvvysfnlvkekpeldqsginswvtgvekvndyqv
kfrlseansnvpyeiakvpvvpkhvwskvkdpstftnenpvgsgpftvidtftpqlyiqc
enpnywdaanldvdclrvpqianndqflgkvvngemdwtssfvpdidrtyaaaspkhhyw
yppagtqafvvnfknpdaaknealtnvdfrrafsmaldrqtiidiafygggtvndfasgl
gyafeawsdekthdkfkaynsynaegakkllakagfkdvnkdgfvdtpsgksfelliqsp
ngwtdfnntvqlaveqlaevgikarartpdfsvynqamlegtydvaytnyfhgadpytyw
nsaynsalqsgdgmprfamhfyknekldgllnsfyktadkqeqleiahgiqqiiaqdqvt
ipvlsgaymyqynttrftgwwneenpkgrpniwagiperllhvldlkpvk

Timeline for d6lzrb1:

• d6lzrb1 is new in SCOPe 2.07-stable
  
• d6lzrb1 appears in the current release, SCOPe 2.08