Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Vibrio harveyi [TaxId:673519] [348941] (8 PDB entries) |
Domain d6lzrb1: 6lzr B:1-530 [399965] Other proteins in same PDB: d6lzra2, d6lzrb2 automated match to d4pfua_ complexed with ca, cl, edo, mg, nag |
PDB Entry: 6lzr (more details), 1.5 Å
SCOPe Domain Sequences for d6lzrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lzrb1 c.94.1.0 (B:1-530) automated matches {Vibrio harveyi [TaxId: 673519]} rseltihpkefttfvrnfnpflgatnlhtttdfiyeplvvfnemhgntpvfrlaenfqms ddlmsvtfdirkgvkwsdgeaftaddvvysfnlvkekpeldqsginswvtgvekvndyqv kfrlseansnvpyeiakvpvvpkhvwskvkdpstftnenpvgsgpftvidtftpqlyiqc enpnywdaanldvdclrvpqianndqflgkvvngemdwtssfvpdidrtyaaaspkhhyw yppagtqafvvnfknpdaaknealtnvdfrrafsmaldrqtiidiafygggtvndfasgl gyafeawsdekthdkfkaynsynaegakkllakagfkdvnkdgfvdtpsgksfelliqsp ngwtdfnntvqlaveqlaevgikarartpdfsvynqamlegtydvaytnyfhgadpytyw nsaynsalqsgdgmprfamhfyknekldgllnsfyktadkqeqleiahgiqqiiaqdqvt ipvlsgaymyqynttrftgwwneenpkgrpniwagiperllhvldlkpvk
Timeline for d6lzrb1: