Lineage for d6ls3h_ (6ls3 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316518Species Thermotoga maritima [TaxId:2336] [399745] (2 PDB entries)
  8. 2316530Domain d6ls3h_: 6ls3 H: [399844]
    automated match to d1vlga_
    complexed with fe, mg; mutant

Details for d6ls3h_

PDB Entry: 6ls3 (more details), 2.82 Å

PDB Description: cubic-shaped crystal of tmftn mutant-t4fy stimulated by mg
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d6ls3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ls3h_ a.25.1.1 (H:) automated matches {Thermotoga maritima [TaxId: 2336]}
mvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfye
yiyerggrveleaiekppsnwagikdafeaalkheefvtqsiynilelaseekdhatvsf
lkwfvdeqveeedqvreildllekaygqmsvifqldrylgqre

SCOPe Domain Coordinates for d6ls3h_:

Click to download the PDB-style file with coordinates for d6ls3h_.
(The format of our PDB-style files is described here.)

Timeline for d6ls3h_: