Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [399745] (2 PDB entries) |
Domain d6ls3h_: 6ls3 H: [399844] automated match to d1vlga_ complexed with fe, mg; mutant |
PDB Entry: 6ls3 (more details), 2.82 Å
SCOPe Domain Sequences for d6ls3h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ls3h_ a.25.1.1 (H:) automated matches {Thermotoga maritima [TaxId: 2336]} mvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfye yiyerggrveleaiekppsnwagikdafeaalkheefvtqsiynilelaseekdhatvsf lkwfvdeqveeedqvreildllekaygqmsvifqldrylgqre
Timeline for d6ls3h_: