SCOPe 2.07: Domain d6lp2d_: 6lp2 D:

Lineage for d6lp2d_ (6lp2 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (19 PDB entries)

8. Domain d6lp2d_: 6lp2 D: [399840]
   Other proteins in same PDB: d6lp2c_
   automated match to d1j7db_

Details for d6lp2d_

PDB Entry: 6lp2, 2.48 Å

PDB Description: structure of lpg2148/ube2n-ub complex

PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d6lp2d_:

Sequence; same for both SEQRES and ATOM records:

>d6lp2d_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

Timeline for d6lp2d_:

• d6lp2d_ is new in SCOPe 2.07-stable
  
• d6lp2d_ appears in the current release, SCOPe 2.08