SCOPe 2.07: Domain d7llzb1: 7llz B:1-61

Lineage for d7llzb1 (7llz B:1-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (33 PDB entries)

8. Domain d7llzb1: 7llz B:1-61 [399820]
   Other proteins in same PDB: d7llza2, d7llza3, d7llzb2, d7llzb3
   automated match to d5tl6b1
   complexed with so4, y61, zn

Details for d7llzb1

PDB Entry: 7llz, 2.9 Å

PDB Description: sars-cov-2 papain-like protease (plpro) bound to inhibitor xr8-69

PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d7llzb1:

Sequence; same for both SEQRES and ATOM records:

>d7llzb1 d.15.1.0 (B:1-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
evrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpn
d

Timeline for d7llzb1:

• d7llzb1 is new in SCOPe 2.07-stable
  
• d7llzb1 appears in the current release, SCOPe 2.08