Lineage for d6legb1 (6leg B:1-181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384864Domain d6legb1: 6leg B:1-181 [399576]
    Other proteins in same PDB: d6lega2, d6lega3, d6lega4, d6legb2, d6legb3, d6legb4, d6legc2, d6legc3, d6legc4, d6legd2, d6legd3, d6legd4
    automated match to d3lpfa1
    complexed with sj5

Details for d6legb1

PDB Entry: 6leg (more details), 2.6 Å

PDB Description: structure of e. coli beta-glucuronidase complex with uronic isofagomine
PDB Compounds: (B:) Beta-D-glucuronidase

SCOPe Domain Sequences for d6legb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6legb1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n

SCOPe Domain Coordinates for d6legb1:

Click to download the PDB-style file with coordinates for d6legb1.
(The format of our PDB-style files is described here.)

Timeline for d6legb1: