Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
Domain d6legb1: 6leg B:1-181 [399576] Other proteins in same PDB: d6lega2, d6lega3, d6lega4, d6legb2, d6legb3, d6legb4, d6legc2, d6legc3, d6legc4, d6legd2, d6legd3, d6legd4 automated match to d3lpfa1 complexed with sj5 |
PDB Entry: 6leg (more details), 2.6 Å
SCOPe Domain Sequences for d6legb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6legb1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]} mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp n
Timeline for d6legb1: